Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YTHDF2 Rabbit pAb (APR22185N)

Product Specifications

Background

This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and may function in binding to RNA. In addition to a YTH domain, this protein has a proline rich region which may be involved in signal transduction. An Alu-rich domain has been identified in one of the introns of this gene, which is thought to be associated with human longevity. In addition, reciprocal translocations between this gene and the Runx1 (AML1) gene on chromosome 21 has been observed in patients with acute myeloid leukemia. This gene was initially mapped to chromosome 14, which was later turned out to be a pseudogene. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality YTHDF2 Rabbit pAb (APR22179N6) .

Synonyms

YTHDF2; CAHL; HGRG8; NY-REN-2

Gene ID

51441

UniProt

Q9Y5A9

Cellular Locus

Cytoplasm, P-body

Applications

IHC (Homo sapiens) WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/62kDa Observed MW: 62KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51441

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5A9

AA Sequence

MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS3 HDR Plasmid (h2)
sc-404639-HDR-2 20 µg

NDUFS3 HDR Plasmid (h2)

Sign In for Pricing
View Details
Mouse Glutamate receptor 4 (GRIA4) ELISA kit
GTR10408564 96 Well

Mouse Glutamate receptor 4 (GRIA4) ELISA kit

Sign In for Pricing
View Details
Acetyl-Alpha-Tubulin (Lys40) (6B5) Mouse mAb
MBS4753898-01 0.1 mL

Acetyl-Alpha-Tubulin (Lys40) (6B5) Mouse mAb

Sign In for Pricing
View Details
Acetyl-Alpha-Tubulin (Lys40) (6B5) Mouse mAb
MBS4753898-02 5x 0.1 mL

Acetyl-Alpha-Tubulin (Lys40) (6B5) Mouse mAb

Sign In for Pricing
View Details
XPNPEP3 Rabbit pAb (APR21472N)
APR21472N-01 50 µL

XPNPEP3 Rabbit pAb (APR21472N)

Sign In for Pricing
View Details
XPNPEP3 Rabbit pAb (APR21472N)
APR21472N-02 100 µL

XPNPEP3 Rabbit pAb (APR21472N)

Sign In for Pricing
View Details