Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL17 Rabbit pAb (APR22172N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPL17 Rabbit pAb (APR22172N) .

Synonyms

MRPL17; L17mt; LIP2; MRP-L17; MRP-L26; RPL17L; RPML26

Gene ID

63875

UniProt

Q9NRX2

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=63875

Uniprot URL

https://www.uniprot.org/uniprot/Q9NRX2

AA Sequence

IPKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDSHLTLLNQLLQGLRQDLRQSQEASNHSSHTAQTPGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SUDS3 shRNA (UAS) - Lentiviral human SUDS3 shRNA (UAS) (25)
GTR15308072 1 Vial

Lentiviral human SUDS3 shRNA (UAS) - Lentiviral human SUDS3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Monoclonal Reg1B Antibody (103) [DyLight 755]
NBP2-89940IR 0.1 mL

Rabbit Monoclonal Reg1B Antibody (103) [DyLight 755]

Sign In for Pricing
View Details
PLXNB2 (Plexin-B2, MM1, KIAA0315) (Biotin) discontinued
131508-Biotin 100 µL

PLXNB2 (Plexin-B2, MM1, KIAA0315) (Biotin) discontinued

Sign In for Pricing
View Details
GCKR Antibody
A49875-50UL 50 μL

GCKR Antibody

Sign In for Pricing
View Details
Simport Cryostore Box 81 x 3-4mL Red
CRY2310 6 / PCK

Simport Cryostore Box 81 x 3-4mL Red

Sign In for Pricing
View Details
netrin G2 CRISPR Activation Plasmid (h2)
sc-413676-ACT-2 20 µg

netrin G2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details