Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL17 Rabbit pAb (APR22172N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPL17 Rabbit pAb (APR22172N) .

Synonyms

MRPL17; L17mt; LIP2; MRP-L17; MRP-L26; RPL17L; RPML26

Gene ID

63875

UniProt

Q9NRX2

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=63875

Uniprot URL

https://www.uniprot.org/uniprot/Q9NRX2

AA Sequence

IPKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDSHLTLLNQLLQGLRQDLRQSQEASNHSSHTAQTPGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound NP-024489
MBS5792945 Inquire

Compound NP-024489

Sign In for Pricing
View Details
ZBTB12 Blocking Peptide
33R-5746 0.1 mg

ZBTB12 Blocking Peptide

Sign In for Pricing
View Details
NSC-70220 (SOS1-IN-1) 10mg
A13160-10 10 mg

NSC-70220 (SOS1-IN-1) 10mg

Sign In for Pricing
View Details
RNU5A-8P Protein Vector (Human) (pPB-N-His)
PV118579 500 ng

RNU5A-8P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MMP17 Antibody - C-terminal region : HRP (ARP64577_P050-HRP)
ARP64577_P050-HRP 100 µL

MMP17 Antibody - C-terminal region : HRP (ARP64577_P050-HRP)

Sign In for Pricing
View Details
TUBD1 Antibody
OAAL00674-100UG 100 µg

TUBD1 Antibody

Sign In for Pricing
View Details