Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP2 Rabbit pAb (APR22149N)

Product Specifications

Background

This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIMP2 Rabbit pAb (APR22149N) .

Synonyms

TIMP2; CSC-21K; DDC8

Gene ID

7077

UniProt

P16035

Cellular Locus

Secreted

Applications

WB (MDA-MB231, Homo sapiens) IF (Homo sapiens, Mus musculus) IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 24KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7077

Uniprot URL

https://www.uniprot.org/uniprot/P16035

AA Sequence

VSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIEN1 Antibody, Biotin conjugated
A68627-50UG 50 µg

MIEN1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)
MBS2004616-01 0.1 mL

Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)
MBS2004616-02 0.2 mL

Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)
MBS2004616-03 0.5 mL

Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)
MBS2004616-04 1 mL

Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)
MBS2004616-05 5 mL

Biotin-Linked Antibody to Receptor II For The Fc Region Of Immunoglobulin E (FceRII)

Sign In for Pricing
View Details