Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrwd1 Rabbit pAb (APR22145N)

Product Specifications

Background

The protein encoded by this gene interacts with components of the origin recognition complex (ORC) and regulates the formation of the prereplicative complex. The encoded protein stabilizes the ORC and therefore aids in DNA replication. This protein is required for the G1/S phase transition of the cell cycle. In addition, the encoded protein binds to trimethylated histone H3 in heterochromatin and recruits the ORC and lysine methyltransferases, which help maintain the repressive heterochromatic state. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Lrwd1 Rabbit pAb (APR22145N) .

Synonyms

LRWD1; CENP-33; ORCA; Lrwd1

Gene ID

222229

UniProt

Q9UFC0

Cellular Locus

Chromosome, Cytoplasm, Nucleus, centromere, centrosome, cytoskeleton, microtubule organizing center, telomere

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 70kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=222229

Uniprot URL

https://www.uniprot.org/uniprot/Q9UFC0

AA Sequence

ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Smr2 (NM_021289) Mouse Tagged Lenti ORF Clone
MR219294L4 10 µg

Smr2 (NM_021289) Mouse Tagged Lenti ORF Clone

Ask
View Details
PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136974-01 0.1 mL

PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Ask
View Details
PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136974-02 0.2 mL

PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Ask
View Details
PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136974-03 0.5 mL

PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Ask
View Details
PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136974-04 1 mL

PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Ask
View Details
PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136974-05 5 mL

PE Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Ask
View Details