Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUD7A Rabbit pAb (APR22140N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OTUD7A Rabbit pAb (APR22140N) .

Synonyms

OTUD7A; C15orf16; C16ORF15; CEZANNE2; OTUD7

Gene ID

170711

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=170711

AA Sequence

RPCATYPQQNRSLWSQSYSPARSALRTVNTVESLAPGGADAPGPAEHKSQTYSNGFGAARDGLEFADADAPAARSNAECGRGGPGPAQRRCQRENCAFYGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME3 Human shRNA Plasmid Kit (Locus ID 4832)
TR316643 1 Kit

NME3 Human shRNA Plasmid Kit (Locus ID 4832)

Sign In for Pricing
View Details
SIRPA Rat Monoclonal Antibody
orb2956831-01 100 µg

SIRPA Rat Monoclonal Antibody

Sign In for Pricing
View Details
SIRPA Rat Monoclonal Antibody
orb2956831-02 1 mg

SIRPA Rat Monoclonal Antibody

Sign In for Pricing
View Details
HLA-DQA2, ID (HLA-DQA2, HLA-DXA, HLA class II histocompatibility antigen, DQ alpha 2 chain, DX alpha chain, HLA class II histocompatibility antigen, DQ (6) alpha chain, HLA-DQA1, MHC class II DQA2) (FITC) discontinued
036624-FITC 200 µL

HLA-DQA2, ID (HLA-DQA2, HLA-DXA, HLA class II histocompatibility antigen, DQ alpha 2 chain, DX alpha chain, HLA class II histocompatibility antigen, DQ (6) alpha chain, HLA-DQA1, MHC class II DQA2) (FITC) discontinued

Sign In for Pricing
View Details
Serinc4 ORF Vector (Mouse) (pORF)
43432014 1.0 µg DNA

Serinc4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Z-Leu-Met-OH
C-2155.0025 25.0g

Z-Leu-Met-OH

Sign In for Pricing
View Details