Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUD7A Rabbit pAb (APR22140N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OTUD7A Rabbit pAb (APR22140N) .

Synonyms

OTUD7A; C15orf16; C16ORF15; CEZANNE2; OTUD7

Gene ID

170711

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=170711

AA Sequence

RPCATYPQQNRSLWSQSYSPARSALRTVNTVESLAPGGADAPGPAEHKSQTYSNGFGAARDGLEFADADAPAARSNAECGRGGPGPAQRRCQRENCAFYGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cellulose Acetate Membrane Filter, 5.0 (μm), 50 (mm), 100pcs/pk
11177237 100 PCS

Cellulose Acetate Membrane Filter, 5.0 (μm), 50 (mm), 100pcs/pk

Sign In for Pricing
View Details
Rabbit Polyclonal SCARA5 Antibody [Alexa Fluor 488]
NBP1-77050AF488 0.1 mL

Rabbit Polyclonal SCARA5 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Atp11a (NM_001293668) Mouse Tagged ORF Clone
MR231617 10 µg

Atp11a (NM_001293668) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ADA2a (TADA2A) (NM_001166105) Human Tagged Lenti ORF Clone
RC228898L4 10 µg

ADA2a (TADA2A) (NM_001166105) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Akp3 ORF Vector (Mouse) (pORF)
ORF038400 1.0 µg DNA

Akp3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CBFA2T2 Human Pre-designed siRNA Set A
HY-RS01993 1 Set

CBFA2T2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details