Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUD7A Rabbit pAb (APR22140N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OTUD7A Rabbit pAb (APR22140N) .

Synonyms

OTUD7A; C15orf16; C16ORF15; CEZANNE2; OTUD7

Gene ID

170711

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=170711

AA Sequence

RPCATYPQQNRSLWSQSYSPARSALRTVNTVESLAPGGADAPGPAEHKSQTYSNGFGAARDGLEFADADAPAARSNAECGRGGPGPAQRRCQRENCAFYGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human USAG1 CF
5370-SD-050 50 µg

Recombinant Human USAG1 CF

Sign In for Pricing
View Details
Anti-HLA-G Alexa Fluor® 488
A4-437-C025 0.025 mg

Anti-HLA-G Alexa Fluor® 488

Sign In for Pricing
View Details
LGR7 (RXFP1) (NM_021634) Human Tagged ORF Clone Lentiviral Particle
RC211338L2V 200 µL

LGR7 (RXFP1) (NM_021634) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pesticide Std Demeton O 2000ug/mL in MeCn - 1ML
REPET330 1 mL

Pesticide Std Demeton O 2000ug/mL in MeCn - 1ML

Sign In for Pricing
View Details
DNM1 Rabbit pAb
E2502902 100 µL

DNM1 Rabbit pAb

Sign In for Pricing
View Details
Anti-Ryanodine Receptor 2 (pS2808) Phospho Antibody
MBS8236073-01 0.03 mL

Anti-Ryanodine Receptor 2 (pS2808) Phospho Antibody

Sign In for Pricing
View Details