Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF598 Rabbit pAb (APR22113N)

Product Specifications

Background

Zinc-finger proteins bind nucleic acids and play important roles in various cellular functions, including cell proliferation, differentiation, and apoptosis. This protein and Grb10-interacting GYF protein 2 have been identified as a components of the mammalian 4EHP (m4EHP) complex. The complex is thought to function as a translation repressor in embryonic development.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF598 Rabbit pAb (APR22113N) .

Synonyms

ZNF598

Gene ID

90850

UniProt

Q86UK7

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa/97kDa/98kDa Observed MW: 115kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=90850

Uniprot URL

https://www.uniprot.org/uniprot/Q86UK7

AA Sequence

PRCPELPPFSLFGDLEQHMRRQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSRSRAEARQNRHIDLQFSYAPRHSRRNEGVVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDQEEGGRPKKEEAAARGPEDPRGPRRSPRTQGEGPGPKETSTNGPVSQEAFSVTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100B Recombinant Rabbit monoclonal Antibody
HA723728 100 µL

S100B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Soft tissue
CB629796 1 Block

Frozen Tissue Blocks, Soft tissue

Sign In for Pricing
View Details
OPHN1 (NM_002547) Human Recombinant Protein
TP314215L 1 mg

OPHN1 (NM_002547) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS647075 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
CCRK (CDK20) Human Gene Knockout Kit (CRISPR)
KN214191RB 1 Kit

CCRK (CDK20) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Human Fibronectin
AA-2701-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Human Fibronectin

Sign In for Pricing
View Details