Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L3 Rabbit pAb (APR22112N)

Product Specifications

Background

This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TPD52L3 Rabbit pAb (APR22112N) .

Synonyms

TPD52L3; NYDSP25; hD55

Gene ID

89882

UniProt

Q96J77

Dilution

WB 1:200 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/15kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=89882

Uniprot URL

https://www.uniprot.org/uniprot/Q96J77

AA Sequence

MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HC Blue No. 8
TRC-H922350-500MG 500 mg

HC Blue No. 8

Sign In for Pricing
View Details
Mouse Tbc1d23 (NM_026254) AAV Particle
MR210025A1V 250 µL

Mouse Tbc1d23 (NM_026254) AAV Particle

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Ribonuclease H (rnhA)
MBS1475042-01 0.02 mg (E-Coli)

Recombinant Pseudoalteromonas haloplanktis Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Ribonuclease H (rnhA)
MBS1475042-02 0.1 mg (E-Coli)

Recombinant Pseudoalteromonas haloplanktis Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Ribonuclease H (rnhA)
MBS1475042-03 0.02 mg (Yeast)

Recombinant Pseudoalteromonas haloplanktis Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Ribonuclease H (rnhA)
MBS1475042-04 0.1 mg (Yeast)

Recombinant Pseudoalteromonas haloplanktis Ribonuclease H (rnhA)

Sign In for Pricing
View Details