Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L3 Rabbit pAb (APR22112N)

Product Specifications

Background

This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TPD52L3 Rabbit pAb (APR22112N) .

Synonyms

TPD52L3; NYDSP25; hD55

Gene ID

89882

UniProt

Q96J77

Dilution

WB 1:200 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/15kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=89882

Uniprot URL

https://www.uniprot.org/uniprot/Q96J77

AA Sequence

MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBA8 AAV siRNA Pooled Vector
48802161 1.0 µg

TUBA8 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human MICAL2 shRNA (UAS) - Lentiviral human MICAL2 shRNA (UAS, RFP) (100)
GTR15162696 1 Vial

Lentiviral human MICAL2 shRNA (UAS) - Lentiviral human MICAL2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Vmn1r35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3042506 1.0 µg DNA

Vmn1r35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal ZDHHC4 Antibody [Janelia Fluor 646]
NBP2-97818JF646 0.1 mL

Rabbit Polyclonal ZDHHC4 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
RPGRIP1L Protein Vector (Rat) (pPM-C-His)
PV302113 500 ng

RPGRIP1L Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein A7 (S100A7) ELISA Kit
YP-W18401-01 48 Tests

Human S100 Calcium Binding Protein A7 (S100A7) ELISA Kit

Sign In for Pricing
View Details