Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTBDN Rabbit pAb (APR22092N)

Product Specifications

Background

This gene was first identified in a study of human eye tissues. The protein encoded by this gene is preferentially expressed in the retina and may play a role in binding retinoids and other carotenoids as it shares homology with riboflavin binding proteins. Alternative splicing results in multiple transcript variants and protein isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RTBDN Rabbit pAb (APR22092N) .

Synonyms

RTBDN; retbindin

Gene ID

83546

UniProt

Q9BSG5

Cellular Locus

Secreted

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/25kDa/28kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=83546

Uniprot URL

https://www.uniprot.org/uniprot/Q9BSG5

AA Sequence

SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STARD3 (CAB1, MLN64, StAR-related Lipid Transfer Protein 3, Metastatic Lymph Node Gene 64 Protein, Protein CAB1, START Domain-containing Protein 3, FLJ41370) (HRP)
133925-HRP 100 µL

STARD3 (CAB1, MLN64, StAR-related Lipid Transfer Protein 3, Metastatic Lymph Node Gene 64 Protein, Protein CAB1, START Domain-containing Protein 3, FLJ41370) (HRP)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
MBS7008214-01 0.02 mg

Recombinant Salmonella dublin Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
MBS7008214-02 0.1 mg

Recombinant Salmonella dublin Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
MBS7008214-03 5x 0.1 mg

Recombinant Salmonella dublin Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing
View Details
Gallus IL6 ELISA Kit
orb561474-01 48 Tests

Gallus IL6 ELISA Kit

Sign In for Pricing
View Details
Gallus IL6 ELISA Kit
orb561474-02 96 Tests

Gallus IL6 ELISA Kit

Sign In for Pricing
View Details