Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF11 Rabbit pAb (APR22086N)

Product Specifications

Background

This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates. Multiple alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DCAF11 Rabbit pAb (APR22076N9) .

Synonyms

DCAF11; GL014; PRO2389; WDR23

Gene ID

80344

UniProt

Q8TEB1

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa/58kDa/61kDa Observed MW: 61kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=80344

Uniprot URL

https://www.uniprot.org/uniprot/Q8TEB1

AA Sequence

MGSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQGGGAANLQFIQALLDSEEENDRAWDGRLGDRYNPPVDATPDTRELEFNEIKTQVELATGQLGLRRAAQKHSFPRMLHQRERGLCHRGSFSLGEQSRVISHFLPNDLGFTDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human STK24 shRNA (UAS) - Lentiviral human STK24 shRNA (UAS) plasmid
GTR15311410 1 Vial

Lentiviral human STK24 shRNA (UAS) - Lentiviral human STK24 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) BRCA2 Polyclonal Antibody
MBS9014652 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) BRCA2 Polyclonal Antibody

Sign In for Pricing
View Details
RPL12P16 siRNA Oligos set (Human)
40767171 3x 5 nmol

RPL12P16 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal EBP Antibody [Janelia Fluor 646]
NBP3-06227JF646 0.1 mL

Rabbit Polyclonal EBP Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
ZNF37A, NT (ZNF37A, KOX21, ZNF37, Zinc finger protein 37A, Zinc finger protein KOX21) (MaxLight 405)
MBS6366398-01 0.1 mL

ZNF37A, NT (ZNF37A, KOX21, ZNF37, Zinc finger protein 37A, Zinc finger protein KOX21) (MaxLight 405)

Sign In for Pricing
View Details
ZNF37A, NT (ZNF37A, KOX21, ZNF37, Zinc finger protein 37A, Zinc finger protein KOX21) (MaxLight 405)
MBS6366398-02 5x 0.1 mL

ZNF37A, NT (ZNF37A, KOX21, ZNF37, Zinc finger protein 37A, Zinc finger protein KOX21) (MaxLight 405)

Sign In for Pricing
View Details