Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF11 Rabbit pAb (APR22086N)

Product Specifications

Background

This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates. Multiple alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DCAF11 Rabbit pAb (APR22076N9) .

Synonyms

DCAF11; GL014; PRO2389; WDR23

Gene ID

80344

UniProt

Q8TEB1

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa/58kDa/61kDa Observed MW: 61kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=80344

Uniprot URL

https://www.uniprot.org/uniprot/Q8TEB1

AA Sequence

MGSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQGGGAANLQFIQALLDSEEENDRAWDGRLGDRYNPPVDATPDTRELEFNEIKTQVELATGQLGLRRAAQKHSFPRMLHQRERGLCHRGSFSLGEQSRVISHFLPNDLGFTDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit D-Dimer (D2D) ELISA Kit
YP-W72029-01 48 Tests

Rabbit D-Dimer (D2D) ELISA Kit

Sign In for Pricing
View Details
Rabbit D-Dimer (D2D) ELISA Kit
YP-W72029-02 96 Tests

Rabbit D-Dimer (D2D) ELISA Kit

Sign In for Pricing
View Details
F (ab') 2 Guinea Pig IgG (H&L) Antibody Fluorescein Conjugated
orb348138 500 μL

F (ab') 2 Guinea Pig IgG (H&L) Antibody Fluorescein Conjugated

Sign In for Pricing
View Details
Mmu-miR-6980-3p agomir
HY-R03690A-01 5 nmol

Mmu-miR-6980-3p agomir

Sign In for Pricing
View Details
Mmu-miR-6980-3p agomir
HY-R03690A-02 20 nmol

Mmu-miR-6980-3p agomir

Sign In for Pricing
View Details
ATR, Phosphorylated (Ser428) (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia and Rad3-related Protein, FRAP-related Protein 1, FRP1) (MaxLight 750)
MBS6444576-01 0.1 mL

ATR, Phosphorylated (Ser428) (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia and Rad3-related Protein, FRAP-related Protein 1, FRP1) (MaxLight 750)

Sign In for Pricing
View Details