Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA4G Rabbit pAb (APR22058N)

Product Specifications

Background

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SEMA4G Rabbit pAb (APR22055N2) .

Synonyms

SEMA4G

Gene ID

57715

UniProt

Q9NTN9

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa/91kDa/92kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57715

Uniprot URL

https://www.uniprot.org/uniprot/Q9NTN9

AA Sequence

ETQVFRESQSVENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAATTIANRSQGSRTALIQDIERGNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARVB Antibody - C-terminal region : HRP (ARP46018_P050-HRP)
ARP46018_P050-HRP 100 µL

PARVB Antibody - C-terminal region : HRP (ARP46018_P050-HRP)

Sign In for Pricing
View Details
Monkey Olfactory receptor 5A2 (OR5A2) ELISA Kit
MBS7226522-01 48 Well

Monkey Olfactory receptor 5A2 (OR5A2) ELISA Kit

Sign In for Pricing
View Details
Monkey Olfactory receptor 5A2 (OR5A2) ELISA Kit
MBS7226522-02 96 Well

Monkey Olfactory receptor 5A2 (OR5A2) ELISA Kit

Sign In for Pricing
View Details
Monkey Olfactory receptor 5A2 (OR5A2) ELISA Kit
MBS7226522-03 5x 96 Well

Monkey Olfactory receptor 5A2 (OR5A2) ELISA Kit

Sign In for Pricing
View Details
Monkey Olfactory receptor 5A2 (OR5A2) ELISA Kit
MBS7226522-04 10x 96 Well

Monkey Olfactory receptor 5A2 (OR5A2) ELISA Kit

Sign In for Pricing
View Details
PIGM Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV696007 1.0 µg DNA

PIGM Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details