Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA4G Rabbit pAb (APR22058N)

Product Specifications

Background

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SEMA4G Rabbit pAb (APR22055N2) .

Synonyms

SEMA4G

Gene ID

57715

UniProt

Q9NTN9

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa/91kDa/92kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57715

Uniprot URL

https://www.uniprot.org/uniprot/Q9NTN9

AA Sequence

ETQVFRESQSVENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAATTIANRSQGSRTALIQDIERGNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK9 Protein Vector (Mouse) (pPB-C-His)
PV199174 500 ng

MAPK9 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Rint1 shRNA (UAS) - Lentiviral mouse Rint1 shRNA (UAS, iRFP) plasmid
GTR15182476 1 Vial

Lentiviral mouse Rint1 shRNA (UAS) - Lentiviral mouse Rint1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
DGAT2 Rabbit Polyclonal Antibody (Cy3)
orb986692 100 µL

DGAT2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Klk11 (NM_001106252) Rat Tagged ORF Clone Lentiviral Particle
RR210478L4V 200 µL

Klk11 (NM_001106252) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Mycobacterium Tuberculosis valS Protein (aa 1-876)
VAng-Yyj0788-inquire Inquire

Recombinant Mycobacterium Tuberculosis valS Protein (aa 1-876)

Sign In for Pricing
View Details
CNIH4 (HSPC163, Protein Cornichon Homolog 4) (MaxLight 650)
MBS6222664-01 0.1 mL

CNIH4 (HSPC163, Protein Cornichon Homolog 4) (MaxLight 650)

Sign In for Pricing
View Details