Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARID1B Rabbit pAb (APR22053N)

Product Specifications

Background

This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARID1B Rabbit pAb (APR22044N8) .

Synonyms

ARID1B; 6A3-5; BAF250B; BRIGHT; CSS1; DAN15; ELD/OSA1; MRD12; OSA2; P250R

Gene ID

57492

UniProt

Q8NFD5

Cellular Locus

Nucleus

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 162kDa/236kDa/237kDa/241kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57492

Uniprot URL

https://www.uniprot.org/uniprot/Q8NFD5

AA Sequence

GGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPYYSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Violet 450 Anti-human CD152 Antibody *BN13*
115200Z0-AAT 100 Tests

MFluor™ Violet 450 Anti-human CD152 Antibody *BN13*

Sign In for Pricing
View Details
Syk-IN-1
BA9027-1 1 mg

Syk-IN-1

Sign In for Pricing
View Details
POM121 Polyclonal Antibody
UB-GEN-13458 100 µL

POM121 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human FOXQ1 sgRNA gene knockout kit - Lentiviral human FOXQ1 sgRNA gene knockout kit (100)
GTR15367594 1 Vial

Lentiviral human FOXQ1 sgRNA gene knockout kit - Lentiviral human FOXQ1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Qdot 525 50 nmol scale
26-6931-05 1 Each

Qdot 525 50 nmol scale

Sign In for Pricing
View Details
Calbindin D9K Lentiviral Activation Particles (m)
sc-419421-LAC 200 µL

Calbindin D9K Lentiviral Activation Particles (m)

Sign In for Pricing
View Details