Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF331 Rabbit pAb (APR22034N)

Product Specifications

Background

This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF331 Rabbit pAb (APR22034N) .

Synonyms

ZNF331; RITA; ZNF361; ZNF463

Gene ID

55422

UniProt

Q9NQX6

Cellular Locus

Nucleus

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa Observed MW: 56kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55422

Uniprot URL

https://www.uniprot.org/uniprot/Q9NQX6

AA Sequence

AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp75 (TRAP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A1]
TA504224AM 100 µL

Hsp75 (TRAP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details
Casp 3/7 FAM-DEVD-FMK 100 Tests
FAM200-2 100 Tests

Casp 3/7 FAM-DEVD-FMK 100 Tests

Sign In for Pricing
View Details
LAP3 Rabbit Monoclonal Antibody
TA422472 100 µL

LAP3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HEPC (HAMP) (NM_021175) Human Recombinant Protein
TP304620 20 µg

HEPC (HAMP) (NM_021175) Human Recombinant Protein

Sign In for Pricing
View Details
CD9 Human Gene Knockout Kit (CRISPR)
KN202000BN 1 Kit

CD9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF640R conjugate, 0.1mg/mL
BNC401474-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details