Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF331 Rabbit pAb (APR22034N)

Product Specifications

Background

This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF331 Rabbit pAb (APR22034N) .

Synonyms

ZNF331; RITA; ZNF361; ZNF463

Gene ID

55422

UniProt

Q9NQX6

Cellular Locus

Nucleus

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa Observed MW: 56kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55422

Uniprot URL

https://www.uniprot.org/uniprot/Q9NQX6

AA Sequence

AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDIA2 Rabbit Polyclonal Antibody (HRP)
orb1595900 100 µL

PDIA2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Mouse CD81 antigen (Cd81), partial
orb1653208-01 20 µg

Recombinant Mouse CD81 antigen (Cd81), partial

Sign In for Pricing
View Details
Recombinant Mouse CD81 antigen (Cd81), partial
orb1653208-02 100 µg

Recombinant Mouse CD81 antigen (Cd81), partial

Sign In for Pricing
View Details
Recombinant Mouse CD81 antigen (Cd81), partial
orb1653208-03 1 mg

Recombinant Mouse CD81 antigen (Cd81), partial

Sign In for Pricing
View Details
C10orf115 Protein Vector (Human) (pPB-C-His)
PV065297 500 ng

C10orf115 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Tmem37 shRNA (UAS) - Lentiviral mouse Tmem37 shRNA (UAS, iRFP) (100)
GTR15204483 1 Vial

Lentiviral mouse Tmem37 shRNA (UAS) - Lentiviral mouse Tmem37 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details