Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA8 Rabbit pAb (APR22027N)

Product Specifications

Background

This gene encodes a component of the chromosomal passenger complex. This complex is an essential regulator of mitosis and cell division. This protein is cell-cycle regulated and is required for chromatin-induced microtubule stabilization and spindle formation. Alternate splicing results in multiple transcript variants. Pseudgenes of this gene are found on chromosomes 7, 8 and 16.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDCA8 Rabbit pAb (APR22023N3) .

Synonyms

CDCA8; BOR; BOREALIN; DasraB; MESRGP; borealin

Gene ID

55143

UniProt

Q53HL2

Cellular Locus

Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, nucleolus, spindle

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55143

Uniprot URL

https://www.uniprot.org/uniprot/Q53HL2

AA Sequence

MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILRLPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVDEMIV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (FITC)
MBS6149074-01 0.1 mL

PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (FITC)

Sign In for Pricing
View Details
PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (FITC)
MBS6149074-02 5x 0.1 mL

PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (FITC)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Mucin 5 Subtype AC (MUC5AC)
MBS2116553-01 0.1 mL

APC-Cy7 Linked Monoclonal Antibody to Mucin 5 Subtype AC (MUC5AC)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Mucin 5 Subtype AC (MUC5AC)
MBS2116553-02 0.2 mL

APC-Cy7 Linked Monoclonal Antibody to Mucin 5 Subtype AC (MUC5AC)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Mucin 5 Subtype AC (MUC5AC)
MBS2116553-03 0.5 mL

APC-Cy7 Linked Monoclonal Antibody to Mucin 5 Subtype AC (MUC5AC)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Mucin 5 Subtype AC (MUC5AC)
MBS2116553-04 1 mL

APC-Cy7 Linked Monoclonal Antibody to Mucin 5 Subtype AC (MUC5AC)

Sign In for Pricing
View Details