Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRNAU1AP Rabbit pAb (APR22022N)

Product Specifications

Background

Involved in the early steps of selenocysteine biosynthesis and tRNA (Sec charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. Stabilizes the SECISBP2, EEFSEC and tRNA (Sec complex. May be involved in the methylation of tRNA (Sec. Enhances efficiency of selenoproteins synthesis (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRNAU1AP Rabbit pAb (APR22022N) .

Synonyms

TRNAU1AP; PRO1902; SECP43; TRSPAP1

Gene ID

54952

UniProt

Q9NX07

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa/32kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54952

Uniprot URL

https://www.uniprot.org/uniprot/Q9NX07

AA Sequence

MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 1 Beta (IL1 beta, Catabolin, H1, Hematopoietin 1, IFN beta Inducing Factor, IL 1, IL 1 beta, IL 1B, IL-1 beta, IL1 Beta, IL1B, IL1B_HUMAN, IL1F2, Interleukin 1 beta Precursor, Interleukin-1 beta, LAF, OAF, Osteoclast Activating Factor, Preinterleukin 1 beta, Preinterleukin beta, Pro Interleukin 1 beta)
303394 100 µg

Interleukin 1 Beta (IL1 beta, Catabolin, H1, Hematopoietin 1, IFN beta Inducing Factor, IL 1, IL 1 beta, IL 1B, IL-1 beta, IL1 Beta, IL1B, IL1B_HUMAN, IL1F2, Interleukin 1 beta Precursor, Interleukin-1 beta, LAF, OAF, Osteoclast Activating Factor, Preinterleukin 1 beta, Preinterleukin beta, Pro Interleukin 1 beta)

Sign In for Pricing
View Details
Lta (Biotin)
567716-01 50 µg

Lta (Biotin)

Sign In for Pricing
View Details
Lta (Biotin)
567716-02 100 µg

Lta (Biotin)

Sign In for Pricing
View Details
Rabbit IgG Isotype Control Antibody (HyHEL-10), PerCP
TF690147-01 1 Each

Rabbit IgG Isotype Control Antibody (HyHEL-10), PerCP

Sign In for Pricing
View Details
Rabbit IgG Isotype Control Antibody (HyHEL-10), PerCP
TF690147-02 100 Tests

Rabbit IgG Isotype Control Antibody (HyHEL-10), PerCP

Sign In for Pricing
View Details
Irx5 Rat siRNA Oligo Duplex (Locus ID 498918)
SR506458 1 Kit

Irx5 Rat siRNA Oligo Duplex (Locus ID 498918)

Sign In for Pricing
View Details