Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANAPC11 Rabbit pAb (APR22011N)

Product Specifications

Background

Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C, a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ANAPC11 Rabbit pAb (APR22011N) .

Synonyms

ANAPC11; APC11; Apc11p; HSPC214

Gene ID

51529

UniProt

Q9NYG5

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/20kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51529

Uniprot URL

https://www.uniprot.org/uniprot/Q9NYG5

AA Sequence

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKAIN1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV771930 1.0 µg DNA

NKAIN1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Rabbit Monoclonal Teplizumab Antibody (2505B) [DyLight 350]
FAB10245D 0.1 mL

Rabbit Monoclonal Teplizumab Antibody (2505B) [DyLight 350]

Sign In for Pricing
View Details
ATP6V0E1 Human shRNA Plasmid Kit (Locus ID 8992)
TL320086 1 Kit

ATP6V0E1 Human shRNA Plasmid Kit (Locus ID 8992)

Sign In for Pricing
View Details
CF®405M Goat Anti-Chicken IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
#20375-50uL 1x 50 µL

CF®405M Goat Anti-Chicken IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS506289 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Transcription factor AP-2 beta (activating enhancer binding Protein 2 beta)
337775 100 µL

Transcription factor AP-2 beta (activating enhancer binding Protein 2 beta)

Sign In for Pricing
View Details