Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANAPC11 Rabbit pAb (APR22011N)

Product Specifications

Background

Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C, a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ANAPC11 Rabbit pAb (APR22011N) .

Synonyms

ANAPC11; APC11; Apc11p; HSPC214

Gene ID

51529

UniProt

Q9NYG5

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/20kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51529

Uniprot URL

https://www.uniprot.org/uniprot/Q9NYG5

AA Sequence

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SNT2 (FRS3) (NM_006653) Human Tagged ORF Clone Lentiviral Particle
RC203801L1V 200 µL

SNT2 (FRS3) (NM_006653) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Transforming Growth Factor beta1 (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation inhibiting factor, Cartilage-inducing factor) (MaxLight 550)
MBS6209552-01 0.1 mL

Transforming Growth Factor beta1 (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation inhibiting factor, Cartilage-inducing factor) (MaxLight 550)

Ask
View Details
Transforming Growth Factor beta1 (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation inhibiting factor, Cartilage-inducing factor) (MaxLight 550)
MBS6209552-02 5x 0.1 mL

Transforming Growth Factor beta1 (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation inhibiting factor, Cartilage-inducing factor) (MaxLight 550)

Ask
View Details
TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (PE)
134350-PE 100 µL

TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (PE)

Ask
View Details
Rat CENPB (Centromere Protein B) ELISA Kit
EKE63350 96 Tests

Rat CENPB (Centromere Protein B) ELISA Kit

Ask
View Details
IDO1, Recombinant, Mouse, aa2-407, His-Tag
544295 50 µg

IDO1, Recombinant, Mouse, aa2-407, His-Tag

Ask
View Details