Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHOD1 Rabbit pAb (APR22000N)

Product Specifications

Background

This gene encodes a protein which is a member of the formin/diaphanous family of proteins. The gene is ubiquitously expressed but is found in abundance in the spleen. The encoded protein has sequence homology to diaphanous and formin proteins within the Formin Homology (FH) 1 and FH2 domains. It also contains a coiled-coil domain, a collagen-like domain, two nuclear localization signals, and several potential PKC and PKA phosphorylation sites. It is a predominantly cytoplasmic protein and is expressed in a variety of human cell lines. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FHOD1 Rabbit pAb (APR22000N) .

Synonyms

FHOD1; FHOS

Gene ID

29109

UniProt

Q9Y613

Cellular Locus

Cell projection, Cytoplasm, bleb, cytoskeleton

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 126kDa Observed MW: 145kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29109

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y613

AA Sequence

TRGRMITETEKFSGVAGEAPSNPSVPVAVSSGPGRGDADSHASMKSLLTSRPEDTTHNRRSRGMVQSSSPIMPTVGPSTASPEEPPGSSLPSDTSDEIMDLLVQSVTKSSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-STAT5A  (Ser780)  Antibody
ABF3303 100 µg

Phospho-STAT5A (Ser780) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Syngr1 shRNA (UAS) - Lentiviral mouse Syngr1 shRNA (UAS) (100)
GTR15294129 1 Vial

Lentiviral mouse Syngr1 shRNA (UAS) - Lentiviral mouse Syngr1 shRNA (UAS) (100)

Sign In for Pricing
View Details
USP48 (9Q2) Mouse Monoclonal antibody
E28PE4828 100 µL

USP48 (9Q2) Mouse Monoclonal antibody

Sign In for Pricing
View Details
PSMC2 Peptide
MBS3228920-01 0.1 mg

PSMC2 Peptide

Sign In for Pricing
View Details
PSMC2 Peptide
MBS3228920-02 5x 0.1 mg

PSMC2 Peptide

Sign In for Pricing
View Details
SON sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2258408 1.0 µg DNA

SON sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details