Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOF Rabbit pAb (APR21989N)

Product Specifications

Background

Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length nature has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MYOF Rabbit pAb (APR21989N) .

Synonyms

MYOF; FER1L3; myoferlin

Gene ID

26509

UniProt

Q9NZM1

Cellular Locus

Cell membrane, Cytoplasmic vesicle membrane, Nucleus membrane, Single-pass type II membrane protein

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/46kDa/49kDa/179kDa/229kDa/233kDa/234kDa Observed MW: 250kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26509

Uniprot URL

https://www.uniprot.org/uniprot/Q9NZM1

AA Sequence

MLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ER beta/NR3A2 Antibody (ESR2/7006R) [DyLight 488]
NBP3-14205G 0.1 mL

Rabbit Monoclonal ER beta/NR3A2 Antibody (ESR2/7006R) [DyLight 488]

Sign In for Pricing
View Details
Lentiviral mouse Slf1 shRNA (UAS) - Lentiviral mouse Slf1 shRNA (UAS, RFP) plasmid
GTR15278257 1 Vial

Lentiviral mouse Slf1 shRNA (UAS) - Lentiviral mouse Slf1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-SPERT antibody
PAab08172 100 µg

Anti-SPERT antibody

Sign In for Pricing
View Details
Chordin (CHRD) (NM_003741) Human Over-expression Lysate
LH06852V 100 µg

Chordin (CHRD) (NM_003741) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Hepacivirus C Genome polyprotein Polyclonal Antibody
MBS7145102 Inquire

Rabbit anti-Hepacivirus C Genome polyprotein Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human SLC22A31 shRNA (UAS) - Lentiviral human SLC22A31 shRNA (UAS, iRFP) (100)
GTR15330822 1 Vial

Lentiviral human SLC22A31 shRNA (UAS) - Lentiviral human SLC22A31 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details