Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOF Rabbit pAb (APR21989N)

Product Specifications

Background

Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length nature has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MYOF Rabbit pAb (APR21989N) .

Synonyms

MYOF; FER1L3; myoferlin

Gene ID

26509

UniProt

Q9NZM1

Cellular Locus

Cell membrane, Cytoplasmic vesicle membrane, Nucleus membrane, Single-pass type II membrane protein

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/46kDa/49kDa/179kDa/229kDa/233kDa/234kDa Observed MW: 250kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26509

Uniprot URL

https://www.uniprot.org/uniprot/Q9NZM1

AA Sequence

MLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hgd shRNA (UAS) - Lentiviral mouse Hgd shRNA (UAS, iRFP) (25)
GTR15252302 1 Vial

Lentiviral mouse Hgd shRNA (UAS) - Lentiviral mouse Hgd shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Phosphate Buffer (PBS), with calcium, magnesium
PB180328 500 mL

Phosphate Buffer (PBS), with calcium, magnesium

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050426-01 0.1 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050426-02 0.2 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050426-03 0.5 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050426-04 1 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details