Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDC4 Rabbit pAb (APR21980N)

Product Specifications

Background

In the process of mRNA degradation, seems to play a role in mRNA decapping. Component of a complex containing DCP2 and DCP1A which functions in decapping of ARE-containing mRNAs. Promotes complex formation between DCP1A and DCP2. Enhances the catalytic activity of DCP2 (in vitro.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EDC4 Rabbit pAb (APR21971N8) .

Synonyms

EDC4; GE1; Ge-1; HEDL5; HEDLS; RCD-8; RCD8

Gene ID

23644

UniProt

Q6P2E9

Cellular Locus

Cytoplasm, Nucleus, P-body

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 109kDa/151kDa Observed MW: 160-180kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23644

Uniprot URL

https://www.uniprot.org/uniprot/Q6P2E9

AA Sequence

GDGDRHNTPSLLEAALTQEASTPDSQVWPTAPDITRETCSTLAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASASGGFGTKVPAPRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDWPALIWQQQRELAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDAIAR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C1QTNF6, NT (Complement C1q Tumor Necrosis Factor-related Protein 6, CTRP6, UNQ581/PRO1151)
MBS625850-01 0.2 mL

C1QTNF6, NT (Complement C1q Tumor Necrosis Factor-related Protein 6, CTRP6, UNQ581/PRO1151)

Ask
View Details
C1QTNF6, NT (Complement C1q Tumor Necrosis Factor-related Protein 6, CTRP6, UNQ581/PRO1151)
MBS625850-02 5x 0.2 mL

C1QTNF6, NT (Complement C1q Tumor Necrosis Factor-related Protein 6, CTRP6, UNQ581/PRO1151)

Ask
View Details
Rabbit Monoclonal CD63 Antibody (LAMP3/8770R) [Alexa Fluor 594]
NBP3-21028AF594 0.1 mL

Rabbit Monoclonal CD63 Antibody (LAMP3/8770R) [Alexa Fluor 594]

Ask
View Details
NR1H4, NT (NR1H4, BAR, FXR, HRR1, RIP14, Bile acid receptor, Farnesoid X-activated receptor, Farnesol receptor HRR-1, Nuclear receptor subfamily 1 group H member 4, Retinoid X receptor-interacting protein 14) (Biotin)
MBS6326514-01 0.2 mL

NR1H4, NT (NR1H4, BAR, FXR, HRR1, RIP14, Bile acid receptor, Farnesoid X-activated receptor, Farnesol receptor HRR-1, Nuclear receptor subfamily 1 group H member 4, Retinoid X receptor-interacting protein 14) (Biotin)

Ask
View Details
NR1H4, NT (NR1H4, BAR, FXR, HRR1, RIP14, Bile acid receptor, Farnesoid X-activated receptor, Farnesol receptor HRR-1, Nuclear receptor subfamily 1 group H member 4, Retinoid X receptor-interacting protein 14) (Biotin)
MBS6326514-02 5x 0.2 mL

NR1H4, NT (NR1H4, BAR, FXR, HRR1, RIP14, Bile acid receptor, Farnesoid X-activated receptor, Farnesol receptor HRR-1, Nuclear receptor subfamily 1 group H member 4, Retinoid X receptor-interacting protein 14) (Biotin)

Ask
View Details
IL13 receptor alpha 1 (IL13RA1) (NM_001560) Human Tagged ORF Clone Lentiviral Particle
RC204928L2V 200 µL

IL13 receptor alpha 1 (IL13RA1) (NM_001560) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details