Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD10 Rabbit pAb (APR21959N)

Product Specifications

Background

This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FZD10 Rabbit pAb (APR21959N) .

Synonyms

FZD10; CD350; FZ-10; Fz10; FzE7; hFz10

Gene ID

11211

UniProt

Q9ULW2

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa Observed MW: 72kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11211

Uniprot URL

https://www.uniprot.org/uniprot/Q9ULW2

AA Sequence

RKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS700062 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human Rho GTPase activating protein 24 (ARHGAP24) (NM_001042669) AAV Particle
RC211886A1V 250 µL

Human Rho GTPase activating protein 24 (ARHGAP24) (NM_001042669) AAV Particle

Sign In for Pricing
View Details
Uncharacterized protein C10orf120 (C10orf120) Human ELISA Kit
I0701 96 Tests

Uncharacterized protein C10orf120 (C10orf120) Human ELISA Kit

Sign In for Pricing
View Details
HK2 Protein Vector (Rat) (pPB-N-His)
PV272923 500 ng

HK2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
HSPA6 sgRNA CRISPR Lentivector (Human) (Target 2)
K0998203 1.0 µg DNA

HSPA6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CEP41 siRNA (m)
sc-142283 10 µM

CEP41 siRNA (m)

Sign In for Pricing
View Details