Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC23IP Rabbit pAb (APR21958N)

Product Specifications

Background

This gene encodes a member of the phosphatidic acid preferring-phospholipase A1 family. The encoded protein is localized to endoplasmic reticulum exit sites and plays a critical role in ER-Golgi transport as part of the multimeric coat protein II complex. An orthologous gene in frogs is required for normal neural crest cell development, suggesting that this gene may play a role in Waardenburg syndrome neural crest defects. Alternatively spliced transcript variants have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SEC23IP Rabbit pAb (APR21958N) .

Synonyms

SEC23IP; MSTP053; P125; P125A

Gene ID

11196

UniProt

Q9Y6Y8

Cellular Locus

COPII-coated vesicle membrane, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum, Peripheral membrane protein

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 102kDa/111kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11196

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y6Y8

AA Sequence

NLSKCPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENKEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLDLKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS708098 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
VRK3 (NM_001025778) Human Over-expression Lysate
LY422459 100 µg

VRK3 (NM_001025778) Human Over-expression Lysate

Sign In for Pricing
View Details
APBA2 (NM_001130414) Human Over-expression Lysate
LC427204 20 µg

APBA2 (NM_001130414) Human Over-expression Lysate

Sign In for Pricing
View Details
14-3-3 beta (YWHAB) Human Gene Knockout Kit (CRISPR)
KN400402 1 Kit

14-3-3 beta (YWHAB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adamts6 Mouse Gene Knockout Kit (CRISPR)
KN500863 1 Kit

Adamts6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details