Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN2 Rabbit pAb (APR21954N)

Product Specifications

Background

This gene encodes a type I transmembrane lectin that shuttles between the endoplasmic reticulum, the Golgi apparatus and the plasma membrane. The encoded protein binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LMAN2 Rabbit pAb (APR21954N) .

Synonyms

LMAN2; C5orf8; GP36B; VIP36; lectin

Gene ID

10960

UniProt

Q12907

Cellular Locus

Endoplasmic reticulum membrane, Endoplasmic reticulum-Golgi intermediate compartment membrane, Golgi apparatus membrane, Single-pass membrane protein, Single-pass type I membrane protein

Dilution

WB 1:200 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10960

Uniprot URL

https://www.uniprot.org/uniprot/Q12907

AA Sequence

HSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD14B Antibody
A42225-100UG 100 µg

ABHD14B Antibody

Sign In for Pricing
View Details
Fcgr1 3'UTR Lenti-reporter-Luc Vector
20382084 1.0 µg

Fcgr1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CAMK2D (Calcium/Calmodulin-Dependent Protein Kinase II delta, CAMKD, DKFZp686G23119, DKFZp686I2288, MGC44911) (Biotin)
244191-Biotin 100 µL

CAMK2D (Calcium/Calmodulin-Dependent Protein Kinase II delta, CAMKD, DKFZp686G23119, DKFZp686I2288, MGC44911) (Biotin)

Sign In for Pricing
View Details
LOC728743 Human qPCR Primer Pair (NM_001080852)
HP204160 200 Reactions

LOC728743 Human qPCR Primer Pair (NM_001080852)

Sign In for Pricing
View Details
TID-1L/S Double Nickase Plasmid (h)
sc-404796-NIC 20 µg

TID-1L/S Double Nickase Plasmid (h)

Sign In for Pricing
View Details
TRNAS17 sgRNA CRISPR Lentivector (Human) (Target 2)
K2523303 1.0 µg DNA

TRNAS17 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details