Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf10 Rabbit pAb (APR21950N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality C6orf10 Rabbit pAb (APR21950N) .

Synonyms

C6orf10; TSBP

Gene ID

10665

UniProt

Q5SRN2

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 61kDa Observed MW: 62kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10665

Uniprot URL

https://www.uniprot.org/uniprot/Q5SRN2

AA Sequence

DEELAKKSCSKIQILKCGGTARSQNSREENKEALKNDIIFTNSVESLKSAHIKEPEREGKGTDLEKDKIGMEVKVDSDAGIPKRQETQLKISEMSIPQGQGAQIKKSVSDVPRGQESQVKKSESGVPKGQEAQVTKSGLVVLKGQEAQVEKSEMGVPRRQESQVKKSQSGVSKGQEAQVKKRESVVLKGQEAQVEKSELKVPKGQEGQVEKTEADVPKEQEVQEKKSEAGVLKGPESQVKNTEVSVPETLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Type X Alpha 1 (COL10A1) Antibody
abx005244-01 20 µL

Collagen Type X Alpha 1 (COL10A1) Antibody

Sign In for Pricing
View Details
Collagen Type X Alpha 1 (COL10A1) Antibody
abx005244-02 100 µL

Collagen Type X Alpha 1 (COL10A1) Antibody

Sign In for Pricing
View Details
Collagen Type X Alpha 1 (COL10A1) Antibody
abx005244-03 2x 100 µL

Collagen Type X Alpha 1 (COL10A1) Antibody

Sign In for Pricing
View Details
MFSD11 (NM_001242535) Human Tagged ORF Clone
RC232747 10 µg

MFSD11 (NM_001242535) Human Tagged ORF Clone

Sign In for Pricing
View Details
C Kit (KIT) Mouse Monoclonal Antibody [Clone ID: LBI2E3]
AMM14923VCF 100 µg

C Kit (KIT) Mouse Monoclonal Antibody [Clone ID: LBI2E3]

Sign In for Pricing
View Details
Recombinant Human IL-10RB/IL-10 R beta Protein
RP00577 10 µg

Recombinant Human IL-10RB/IL-10 R beta Protein

Sign In for Pricing
View Details