Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFM4 Rabbit pAb (APR21946N)

Product Specifications

Background

This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth and is an extracellular matrix glycoprotein that facilitates cell adhesion.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OLFM4 Rabbit pAb (APR21946N) .

Synonyms

OLFM4; GC1; GW112; OLM4; OlfD; UNQ362; bA209J19.1; hGC-1; hOLfD

Gene ID

10562

UniProt

Q6UX06

Cellular Locus

Mitochondrion, Secreted, extracellular space

Dilution

WB 1:200 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 75-80KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10562

Uniprot URL

https://www.uniprot.org/uniprot/Q6UX06

AA Sequence

AIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNTWYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLNYDLSVLQKPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Apolipoprotein F (APOF)
TRV-0009278-01 10 µg

Recombinant Apolipoprotein F (APOF)

Sign In for Pricing
View Details
Recombinant Apolipoprotein F (APOF)
TRV-0009278-02 50 µg

Recombinant Apolipoprotein F (APOF)

Sign In for Pricing
View Details
Recombinant Apolipoprotein F (APOF)
TRV-0009278-03 100 µg

Recombinant Apolipoprotein F (APOF)

Sign In for Pricing
View Details
Recombinant Apolipoprotein F (APOF)
TRV-0009278-04 200 µg

Recombinant Apolipoprotein F (APOF)

Sign In for Pricing
View Details
Recombinant Apolipoprotein F (APOF)
TRV-0009278-05 500 µg

Recombinant Apolipoprotein F (APOF)

Sign In for Pricing
View Details
Recombinant Apolipoprotein F (APOF)
TRV-0009278-06 1 mg

Recombinant Apolipoprotein F (APOF)

Sign In for Pricing
View Details