Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FIG4 Rabbit pAb (APR21930N)

Product Specifications

Background

The protein encoded by this gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. The yeast homolog, Sac1p, is involved in the regulation of various phosphoinositides, and affects diverse cellular functions such as actin cytoskeleton organization, Golgi function, and maintenance of vacuole morphology. Membrane-bound phosphoinositides function as signaling molecules and play a key role in vesicle trafficking in eukaryotic cells. Mutations in this gene have been associated with Charcot-Marie-Tooth disease, type 4J.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FIG4 Rabbit pAb (APR21930N) .

Synonyms

FIG4; ALS11; BTOP; CMT4J; KIAA0274; SAC3; YVS; dJ249I4.1

Gene ID

9896

UniProt

Q92562

Cellular Locus

Endosome membrane

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa Observed MW: 104kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9896

Uniprot URL

https://www.uniprot.org/uniprot/Q92562

AA Sequence

WELPTDFYLHHKNTMRLLPTRRSYTYWWTPEVIKHLPLPYDEVICAVNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVKMTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCSRCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYREYIRNRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BASP1 Peptide - C-terminal region
MBS3239511-01 0.1 mg

BASP1 Peptide - C-terminal region

Sign In for Pricing
View Details
BASP1 Peptide - C-terminal region
MBS3239511-02 5x 0.1 mg

BASP1 Peptide - C-terminal region

Sign In for Pricing
View Details
Mouse Tsga10 Pre-designed siRNA Set A
SI115348A 1 Each

Mouse Tsga10 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GPR3 Protein Vector (Mouse) (pPB-C-His)
PV186158 500 ng

GPR3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Anti-NOL6 antibody
SL19312R-01 50 µL

Rabbit Anti-NOL6 antibody

Sign In for Pricing
View Details
Rabbit Anti-NOL6 antibody
SL19312R-02 100 µL

Rabbit Anti-NOL6 antibody

Sign In for Pricing
View Details