Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIT2 Rabbit pAb (APR21925N)

Product Specifications

Background

This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GIT2 Rabbit pAb (APR21925N) .

Synonyms

GIT2; CAT-2; CAT2; PKL

Gene ID

9815

UniProt

Q14161

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa, 70-84kDa Observed MW: 84kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9815

Uniprot URL

https://www.uniprot.org/uniprot/Q14161

AA Sequence

ASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human NFKB1 pAb
PA8376-01 50 μL

Rabbit Anti-Human NFKB1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NFKB1 pAb
PA8376-02 100 μL

Rabbit Anti-Human NFKB1 pAb

Sign In for Pricing
View Details
Rat Autophagy Related Protein 7 (ATG7) ELISA Kit
SL2045Ra-01 48 Tests

Rat Autophagy Related Protein 7 (ATG7) ELISA Kit

Sign In for Pricing
View Details
Rat Autophagy Related Protein 7 (ATG7) ELISA Kit
SL2045Ra-02 96 Tests

Rat Autophagy Related Protein 7 (ATG7) ELISA Kit

Sign In for Pricing
View Details
CD27 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-54318R-BF594 100 µL

CD27 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
DCAF5 siRNA (Human)
MBS829191-01 15 nmol

DCAF5 siRNA (Human)

Sign In for Pricing
View Details