Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIT2 Rabbit pAb (APR21925N)

Product Specifications

Background

This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GIT2 Rabbit pAb (APR21925N) .

Synonyms

GIT2; CAT-2; CAT2; PKL

Gene ID

9815

UniProt

Q14161

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa, 70-84kDa Observed MW: 84kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9815

Uniprot URL

https://www.uniprot.org/uniprot/Q14161

AA Sequence

ASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLLT3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
30207126 3x 1.0µg DNA

MLLT3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
EPCAM Mouse Monoclonal Antibody [Clone ID: LBI2D9]
AMM13902V 100 µL

EPCAM Mouse Monoclonal Antibody [Clone ID: LBI2D9]

Sign In for Pricing
View Details
Recombinant Human CD66d/CEACAM3 Protein, C-His
orb2961399-01 50 µg

Recombinant Human CD66d/CEACAM3 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD66d/CEACAM3 Protein, C-His
orb2961399-02 100 µg

Recombinant Human CD66d/CEACAM3 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD66d/CEACAM3 Protein, C-His
orb2961399-03 1 mg

Recombinant Human CD66d/CEACAM3 Protein, C-His

Sign In for Pricing
View Details
KHDRBS1 (KH Domain-containing, RNA-binding, Signal Transduction-associated Protein 1, FLJ34027, GAP-associated Tyrosine Phosphoprotein p62, p21 Ras GTPase-activating Protein-associated p62, p62, p68, Src-associated in Mitosis 68kD Protein, Sam68)
128778 100 µg

KHDRBS1 (KH Domain-containing, RNA-binding, Signal Transduction-associated Protein 1, FLJ34027, GAP-associated Tyrosine Phosphoprotein p62, p21 Ras GTPase-activating Protein-associated p62, p62, p68, Src-associated in Mitosis 68kD Protein, Sam68)

Sign In for Pricing
View Details