Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESPL1 Rabbit pAb (APR21923N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ESPL1 Rabbit pAb (APR21923N) .

Synonyms

ESPL1; ESP1; SEPA; separin

Gene ID

9700

UniProt

Q14674

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 197kDa/233kDa Observed MW: 233kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9700

Uniprot URL

https://www.uniprot.org/uniprot/Q14674

AA Sequence

DEILAQAYTLLALEGLNQPSNESLQKVLQSGLKFVAARIPHLEPWRASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIKSVPGSEPSKTQGQKRSGRGRQKLASAPLRLNNTSQKGLEGRGLPCTPKPPDRIRQAGPHVPFTVFEEVCPTESKPEVPQAPRVQQRVQTRLKVNFSDDSDLEDPVSAEAWLAEEPKRRGTASRGRGRARKGLSLKTDAVVAPGSAPGNPGLNGRSRRAKKVASRHCEERRPQRASDQARPGPEIMRTIPEEELTDNWRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella suis ATP synthase subunit delta (atpH)
MBS1127643-01 0.05 mg (E-Coli)

Recombinant Brucella suis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Brucella suis ATP synthase subunit delta (atpH)
MBS1127643-02 0.05 mg (Yeast)

Recombinant Brucella suis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Brucella suis ATP synthase subunit delta (atpH)
MBS1127643-03 0.2 mg (E-Coli)

Recombinant Brucella suis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Brucella suis ATP synthase subunit delta (atpH)
MBS1127643-04 0.5 mg (E-Coli)

Recombinant Brucella suis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Brucella suis ATP synthase subunit delta (atpH)
MBS1127643-05 0.05 mg (Baculovirus)

Recombinant Brucella suis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Brucella suis ATP synthase subunit delta (atpH)
MBS1127643-06 0.2 mg (Yeast)

Recombinant Brucella suis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details