Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEZ1 Rabbit pAb (APR21918N)

Product Specifications

Background

This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FEZ1 Rabbit pAb (APR21918N) .

Synonyms

FEZ1; UNC-76

Gene ID

9638

UniProt

Q99689

Cellular Locus

Cell membrane, Cytoplasm, centrosome, cytoskeleton, microtubule organizing center

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/45kDa Observed MW: 71kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9638

Uniprot URL

https://www.uniprot.org/uniprot/Q99689

AA Sequence

MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Tcl1b2 shRNA (UAS) - Lentiviral mouse Tcl1b2 shRNA (UAS) (25)
GTR15223517 1 Vial

Lentiviral mouse Tcl1b2 shRNA (UAS) - Lentiviral mouse Tcl1b2 shRNA (UAS) (25)

Ask
View Details
P53 Binding Protein 1 (53BP1, 53-BP1, FLJ41424, MGC138366, p202, p53BP1, Tumor Protein 53 Binding Protein 1, Tumor Protein p53 Binding Protein 1, TP53BP1, Tumor Suppressor p53 Binding Protein 1) (HRP) discontinued
P1001-25H-HRP 100 µL

P53 Binding Protein 1 (53BP1, 53-BP1, FLJ41424, MGC138366, p202, p53BP1, Tumor Protein 53 Binding Protein 1, Tumor Protein p53 Binding Protein 1, TP53BP1, Tumor Suppressor p53 Binding Protein 1) (HRP) discontinued

Ask
View Details
LGP2, NT (D11LGP2, D11LGP2E, DEXH (Asp-Glu-X-His) Box Polypeptide 58, DHX58, Probable ATP-dependent RNA Helicase DHX58, Probable ATP-dependent Helicase LGP2, Protein D11Lgp2 Homolog, RIG-I-like Receptor LGP2, RLR) (MaxLight 490) discontinued
L2146-02-ML490 100 µL

LGP2, NT (D11LGP2, D11LGP2E, DEXH (Asp-Glu-X-His) Box Polypeptide 58, DHX58, Probable ATP-dependent RNA Helicase DHX58, Probable ATP-dependent Helicase LGP2, Protein D11Lgp2 Homolog, RIG-I-like Receptor LGP2, RLR) (MaxLight 490) discontinued

Ask
View Details
Lipoprotein-associated phospholipase A2 (Lp-PLA2) antibody
NBP0208-1 1 mg

Lipoprotein-associated phospholipase A2 (Lp-PLA2) antibody

Ask
View Details
Influenza Virus NS1A Binding Protein (IVNS1ABP) (NM_006469) Human Tagged ORF Clone Lentiviral Particle
RC209701L4V 200 µL

Influenza Virus NS1A Binding Protein (IVNS1ABP) (NM_006469) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Recombinant Bacillus cereus GTPase obg (obg)
MBS1042303-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus GTPase obg (obg)

Ask
View Details