Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTPBP1 Rabbit pAb (APR21916N)

Product Specifications

Background

This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GTPBP1 Rabbit pAb (APR21916N) .

Synonyms

GTPBP1; GP-1; GP1; HSPC018

Gene ID

9567

UniProt

O00178

Cellular Locus

Cytoplasm

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 72kDa Observed MW: 72kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9567

Uniprot URL

https://www.uniprot.org/uniprot/O00178

AA Sequence

MDSPVPASMFAPEPSSPGAARAAAAAARLHGGFDSDCSEDGEALNGEPELDLTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM55 ORF Vector (Human) (pORF)
47803011 1.0 µg DNA

TRIM55 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Gap junction alpha-5 protein, Gja5 ELISA KIT
ELI-08900m 96 Tests

Mouse Gap junction alpha-5 protein, Gja5 ELISA KIT

Sign In for Pricing
View Details
Mouse A930003A15Rik activation kit by CRISPRa
GA207702 1 Kit

Mouse A930003A15Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Canine Tumor Necrosis Factor Receptor Superfamily, Member 27 (TNFRSF27) ELISA Kit
MBS9354530-01 48 Well

Canine Tumor Necrosis Factor Receptor Superfamily, Member 27 (TNFRSF27) ELISA Kit

Sign In for Pricing
View Details
Canine Tumor Necrosis Factor Receptor Superfamily, Member 27 (TNFRSF27) ELISA Kit
MBS9354530-02 96 Well

Canine Tumor Necrosis Factor Receptor Superfamily, Member 27 (TNFRSF27) ELISA Kit

Sign In for Pricing
View Details
Canine Tumor Necrosis Factor Receptor Superfamily, Member 27 (TNFRSF27) ELISA Kit
MBS9354530-03 5x 96 Well

Canine Tumor Necrosis Factor Receptor Superfamily, Member 27 (TNFRSF27) ELISA Kit

Sign In for Pricing
View Details