Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1E1 Rabbit pAb (APR21914N)

Product Specifications

Background

This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EEF1E1 Rabbit pAb (APR21914N) .

Synonyms

EEF1E1; AIMP3; P18

Gene ID

9521

UniProt

O43324

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa/19kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9521

Uniprot URL

https://www.uniprot.org/uniprot/O43324

AA Sequence

MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse 5'-Nucleotidase Protein
MBS2557419-01 0.01 mg

Recombinant Mouse 5'-Nucleotidase Protein

Sign In for Pricing
View Details
Recombinant Mouse 5'-Nucleotidase Protein
MBS2557419-02 0.05 mg

Recombinant Mouse 5'-Nucleotidase Protein

Sign In for Pricing
View Details
Recombinant Mouse 5'-Nucleotidase Protein
MBS2557419-03 5x 0.05 mg

Recombinant Mouse 5'-Nucleotidase Protein

Sign In for Pricing
View Details
TMEM50B Protein Vector (Human) (pPM-C-His)
PV136253 500 ng

TMEM50B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human anti-gliadin (GL) antibody (IgM) Elisa Kit
EK714442 96 Well

Human anti-gliadin (GL) antibody (IgM) Elisa Kit

Sign In for Pricing
View Details
Tbrg1 (NM_025289) Mouse Tagged ORF Clone Lentiviral Particle
MR206034L4V 200 µL

Tbrg1 (NM_025289) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details