Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR6 Rabbit pAb (APR21905N)

Product Specifications

Background

Phosphatase that acts on lipids with a phosphoinositol headgroup. Dephosphorylates phosphatidylinositol 3-phosphate (PtdIns (3P and phosphatidylinositol 3,5-bisphosphate (Probable. Binds with high affinity to phosphatidylinositol 3,5-bisphosphate (PtdIns (3,5P2 but also to phosphatidylinositol 3-phosphate (PtdIns (3P, phosphatidylinositol 4-phosphate (PtdIns (4P, and phosphatidylinositol 5-phosphate (PtdIns (5P, phosphatidic acid and phosphatidylserine. Negatively regulates ER-Golgi protein transport (By similarity. Probably in association with MTMR9, plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3-phosphate in membrane ruffles. Acts as a negative regulator of KCNN4/KCa3.1 channel activity in CD4 (+ T-cells possibly by decreasing intracellular levels of phosphatidylinositol 3-phosphate. Negatively regulates proliferation of reactivated CD4 (+ T-cells. In complex with MTMR9, negatively regulates DNA damage-induced apoptosis. The formation of the MTMR6-MTMR9 complex stabilizes both MTMR6 and MTMR9 protein levels.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MTMR6 Rabbit pAb (APR21905N) .

Synonyms

MTMR6

Gene ID

9107

UniProt

Q9Y217

Cellular Locus

Nucleus envelope

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 63kDa/71kDa Observed MW: 72kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9107

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y217

AA Sequence

RCGQLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEAFLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLEDQKKYLNPLYSSESHRFTVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESKIKQRKNKQTDGILTKELLHSVHPESPNLKTSLCFKEQTLLPVNDALRTIEGSSPADNRYSEYAEEFSKSEPAVVSLEYGVARMTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Tumor necrosis factor receptor superfamily member 9 (Tnfrsf9)
orb2902841-01 20 µg

Recombinant Mouse Tumor necrosis factor receptor superfamily member 9 (Tnfrsf9)

Sign In for Pricing
View Details
Recombinant Mouse Tumor necrosis factor receptor superfamily member 9 (Tnfrsf9)
orb2902841-02 100 µg

Recombinant Mouse Tumor necrosis factor receptor superfamily member 9 (Tnfrsf9)

Sign In for Pricing
View Details
Sod3 3'UTR Luciferase Stable Cell Line
TU119460 1.0 mL

Sod3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C17orf100 Recombinant Protein (Human)
RP049369 100 µg

C17orf100 Recombinant Protein (Human)

Sign In for Pricing
View Details
(5-Aminopyridin-2-yl) -carbamic acid tert-butyl ester ≥95% (HPLC)
233894-01 100 mg

(5-Aminopyridin-2-yl) -carbamic acid tert-butyl ester ≥95% (HPLC)

Sign In for Pricing
View Details
(5-Aminopyridin-2-yl) -carbamic acid tert-butyl ester ≥95% (HPLC)
233894-02 250 mg

(5-Aminopyridin-2-yl) -carbamic acid tert-butyl ester ≥95% (HPLC)

Sign In for Pricing
View Details