Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC3 Rabbit pAb (APR21904N)

Product Specifications

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CLIC3 Rabbit pAb (APR21904N) .

Synonyms

CLIC3

Gene ID

9022

UniProt

O95833

Cellular Locus

Cytoplasm, Membrane, Nucleus, Single-pass membrane protein

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9022

Uniprot URL

https://www.uniprot.org/uniprot/O95833

AA Sequence

GPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Bis (2-chloroethyl) disulfane
OR1047306-01 100 mg

1,2-Bis (2-chloroethyl) disulfane

Sign In for Pricing
View Details
1,2-Bis (2-chloroethyl) disulfane
OR1047306-02 250 mg

1,2-Bis (2-chloroethyl) disulfane

Sign In for Pricing
View Details
1,2-Bis (2-chloroethyl) disulfane
OR1047306-03 1 g

1,2-Bis (2-chloroethyl) disulfane

Sign In for Pricing
View Details
Recombinant Human SUMO4 Protein
E30P11762 20 µg

Recombinant Human SUMO4 Protein

Sign In for Pricing
View Details
PLAUR (NM_002659) Human Mass Spec Standard
PH301222 10 µg

PLAUR (NM_002659) Human Mass Spec Standard

Sign In for Pricing
View Details
ZBTB8B Protein Vector (Mouse) (pPB-C-His)
PV248398 500 ng

ZBTB8B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details