Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYH13 Rabbit pAb (APR21900N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MYH13 Rabbit pAb (APR21900N) .

Synonyms

MYH13; MyHC-IIL; MyHC-eo; myosin-13

Gene ID

544791

Cellular Locus

Cytoplasm, myofibril

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 223kDa Observed MW: 300kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=544791

AA Sequence

FKNKLYDQHLGKSNNFQKPKPTKGKAEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSSLKLLSFLFSNYAGAEAGDSAGGKKGGKKKGSSFQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101C-01 50 Tests

FITC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
FITC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101C-02 100 Tests

FITC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
FITC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101C-03 2x 100 Tests

FITC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
Adcy2 Mouse Gene Knockout Kit (CRISPR)
KN500888 1 Kit

Adcy2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), 0.2mg/mL
BNUB0531-500 1x 500 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Rectum
CR562630 5 µg

Tissue Total RNA, Rectum

Sign In for Pricing
View Details