Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYH13 Rabbit pAb (APR21900N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MYH13 Rabbit pAb (APR21900N) .

Synonyms

MYH13; MyHC-IIL; MyHC-eo; myosin-13

Gene ID

544791

Cellular Locus

Cytoplasm, myofibril

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 223kDa Observed MW: 300kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=544791

AA Sequence

FKNKLYDQHLGKSNNFQKPKPTKGKAEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSSLKLLSFLFSNYAGAEAGDSAGGKKGGKKKGSSFQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin gamma 1 (LAMC1) Rabbit Polyclonal Antibody
AP02273SU-S 20 µL

Laminin gamma 1 (LAMC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS506289 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Recombinant Human XRCC5 & XRCC6 Heterodimer Protein
PKSH030480 50 µg

Recombinant Human XRCC5 & XRCC6 Heterodimer Protein

Sign In for Pricing
View Details
GARNL3 Rabbit Polyclonal Antibody
TA368357 100 µL

GARNL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Tropomyosin alpha 1 Chain Antibody
RC-15092-01 50 μL

Recombinant Tropomyosin alpha 1 Chain Antibody

Sign In for Pricing
View Details
Recombinant Tropomyosin alpha 1 Chain Antibody
RC-15092-02 100 µL

Recombinant Tropomyosin alpha 1 Chain Antibody

Sign In for Pricing
View Details