Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM26 Rabbit pAb (APR21889N)

Product Specifications

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The gene localizes to the major histocompatibility complex (MHC) class I region on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Synonyms

TRIM26; AFP; RNF95; ZNF173

Gene ID

7726

UniProt

Q12899

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 62kDa Observed MW: 62kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRIM26 Rabbit pAb (APR21889N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7726

Uniprot URL

https://www.uniprot.org/uniprot/Q12899

AA Sequence

MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPFKKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WFDC5 (PRG5, WAP1, WAP Four-disulfide Core Domain Protein 5, Putative Protease Inhibitor WAP1, p53-responsive Gene 5 Protein) (MaxLight 750)
MBS6236134-01 0.1 mL

WFDC5 (PRG5, WAP1, WAP Four-disulfide Core Domain Protein 5, Putative Protease Inhibitor WAP1, p53-responsive Gene 5 Protein) (MaxLight 750)

Ask
View Details
WFDC5 (PRG5, WAP1, WAP Four-disulfide Core Domain Protein 5, Putative Protease Inhibitor WAP1, p53-responsive Gene 5 Protein) (MaxLight 750)
MBS6236134-02 5x 0.1 mL

WFDC5 (PRG5, WAP1, WAP Four-disulfide Core Domain Protein 5, Putative Protease Inhibitor WAP1, p53-responsive Gene 5 Protein) (MaxLight 750)

Ask
View Details
TCEA1 Antibody - middle region: HRP (ARP37150_T100-HRP)
ARP37150_T100-HRP 100 µL

TCEA1 Antibody - middle region: HRP (ARP37150_T100-HRP)

Ask
View Details
KRTAP1-5 Protein Lysate (Mouse) with C-HA Tag
26107034 100 μg

KRTAP1-5 Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
Hemoglobin (3-prime alpha-globin gene, Alpha globin, alpha-1 globin, Beta globin, CD113t C, CD31, Erythremia, beta-globin, Gamma 1 globin, Hb F Agamma, HBA 1, HBA 2, HBA, HBA_Human, HBA1, HBA2, HBB, Hbb-y, HBD, Hbe1, HBG 1, HBG, HBG1, HBGA, HBGR, HBH, Hem
MBS6260488-01 0.1 mL

Hemoglobin (3-prime alpha-globin gene, Alpha globin, alpha-1 globin, Beta globin, CD113t C, CD31, Erythremia, beta-globin, Gamma 1 globin, Hb F Agamma, HBA 1, HBA 2, HBA, HBA_Human, HBA1, HBA2, HBB, Hbb-y, HBD, Hbe1, HBG 1, HBG, HBG1, HBGA, HBGR, HBH, Hem

Ask
View Details
Hemoglobin (3-prime alpha-globin gene, Alpha globin, alpha-1 globin, Beta globin, CD113t C, CD31, Erythremia, beta-globin, Gamma 1 globin, Hb F Agamma, HBA 1, HBA 2, HBA, HBA_Human, HBA1, HBA2, HBB, Hbb-y, HBD, Hbe1, HBG 1, HBG, HBG1, HBGA, HBGR, HBH, Hem
MBS6260488-02 5x 0.1 mL

Hemoglobin (3-prime alpha-globin gene, Alpha globin, alpha-1 globin, Beta globin, CD113t C, CD31, Erythremia, beta-globin, Gamma 1 globin, Hb F Agamma, HBA 1, HBA 2, HBA, HBA_Human, HBA1, HBA2, HBB, Hbb-y, HBD, Hbe1, HBG 1, HBG, HBG1, HBGA, HBGR, HBH, Hem

Ask
View Details