Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNT3 Rabbit pAb (APR21881N)

Product Specifications

Background

The binding of Ca (2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca (2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments. The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction. The troponin complex has protein subunits C, I, and T. Subunit C binds Ca (2+) and subunit I binds to actin and inhibits actin-myosin interaction. Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca (2+) -mediated activation of actomyosin ATPase activity. There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle. This gene encodes fast skeletal troponin T protein; also known as troponin T type 3. Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms. A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs. Additional splice variants have been described but their biological validity has not been established. Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TNNT3 Rabbit pAb (APR21881N) .

Synonyms

TNNT3; TNTF; troponin T3

Gene ID

7140

UniProt

P45378

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/30kDa/31kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7140

Uniprot URL

https://www.uniprot.org/uniprot/P45378

AA Sequence

SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Btnl10 Mouse Gene Knockout Kit (CRISPR)
KN502315 1 Kit

Btnl10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS627188 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Ccdc50 Mouse Gene Knockout Kit (CRISPR)
KN302719LP 1 Kit

Ccdc50 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (AE-2), CF568 conjugate, 0.1mg/mL
BNC680946-100 1x 100 µL

Double Stranded DNA (dsDNA) (AE-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-c-Jun (T91) Recombinant Rabbit Monoclonal Antibody [JJ080-9]
ET1701-32 100 µL

Phospho-c-Jun (T91) Recombinant Rabbit Monoclonal Antibody [JJ080-9]

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), 1mg/mL
BNUM2074-50 1x 50 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), 1mg/mL

Sign In for Pricing
View Details