Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCP3 Rabbit pAb (APR21877N)

Product Specifications

Background

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP) . UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. The different UCPs have tissue-specific expression; this gene is primarily expressed in skeletal muscle. This gene's protein product is postulated to protect mitochondria against lipid-induced oxidative stress. Expression levels of this gene increase when fatty acid supplies to mitochondria exceed their oxidation capacity and the protein enables the export of fatty acids from mitochondria. UCPs contain the three solcar protein domains typically found in MACPs. Two splice variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UCP3 Rabbit pAb (APR21877N) .

Synonyms

UCP3; SLC25A9

Gene ID

7352

UniProt

P55916

Cellular Locus

Mitochondrion inner membrane, Multi-pass membrane protein

Applications

WB (Mus musculus, Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/29kDa/34kDa Observed MW: 34kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7352

Uniprot URL

https://www.uniprot.org/uniprot/P55916

AA Sequence

MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARNT2 Human qPCR Primer Pair (NM_014862)
HP211210 200 Reactions

ARNT2 Human qPCR Primer Pair (NM_014862)

Sign In for Pricing
View Details
Anti-CD40 Antibody (PE), Mouse Monoclonal
MBS8112778-01 25 Tests

Anti-CD40 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD40 Antibody (PE), Mouse Monoclonal
MBS8112778-02 100 Tests

Anti-CD40 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD40 Antibody (PE), Mouse Monoclonal
MBS8112778-03 5x 100 Tests

Anti-CD40 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
SALL3 Antibody-N-terminal region
MBS3249306-01 0.1 mg

SALL3 Antibody-N-terminal region

Sign In for Pricing
View Details
SALL3 Antibody-N-terminal region
MBS3249306-02 5x 0.1 mg

SALL3 Antibody-N-terminal region

Sign In for Pricing
View Details