Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8 Rabbit pAb (APR21872N)

Product Specifications

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms

S100A8; 60B8AG; CAGA; CFAG; CGLA; CP-10; L1Ag; MA387; MIF; MRP8; NIF; P8

Gene ID

6279

UniProt

P05109

Cellular Locus

Cell membrane, Cytoplasm, Peripheral membrane protein, Secreted, cytoskeleton

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: 11kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality S100A8 Rabbit pAb (APR21872N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6279

Uniprot URL

https://www.uniprot.org/uniprot/P05109

AA Sequence

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541) (MaxLight 550)
MBS6213038-01 0.1 mL

PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541) (MaxLight 550)

Ask
View Details
PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541) (MaxLight 550)
MBS6213038-02 5x 0.1 mL

PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541) (MaxLight 550)

Ask
View Details
Recombinant Glutamine synthetase (GS)
RPD761Hu01-01 10 µg

Recombinant Glutamine synthetase (GS)

Ask
View Details
Recombinant Glutamine synthetase (GS)
RPD761Hu01-02 50 µg

Recombinant Glutamine synthetase (GS)

Ask
View Details
Recombinant Glutamine synthetase (GS)
RPD761Hu01-03 100 µg

Recombinant Glutamine synthetase (GS)

Ask
View Details
Recombinant Glutamine synthetase (GS)
RPD761Hu01-04 200 µg

Recombinant Glutamine synthetase (GS)

Ask
View Details