Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS25 Rabbit pAb (APR21871N)

Product Specifications

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S25E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPS25 Rabbit pAb (APR21871N) .

Synonyms

RPS25; S25

Gene ID

6230

UniProt

P62851

Applications

WB (Homo sapiens)

Dilution

WB 1:200 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6230

Uniprot URL

https://www.uniprot.org/uniprot/P62851

AA Sequence

FDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant EBOV (Subtype Sudan, strain Gulu) Glycoprotein / GP1 (mucin domain deleted) Protein (His Tag)
PKSV030142 100 µg

Recombinant EBOV (Subtype Sudan, strain Gulu) Glycoprotein / GP1 (mucin domain deleted) Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin 7 Recombinant Mouse Monoclonal Antibody [3-G3-D8-R]
HA601065 100 µL

Cytokeratin 7 Recombinant Mouse Monoclonal Antibody [3-G3-D8-R]

Sign In for Pricing
View Details
MRPS7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E11]
TA803297BM 100 µL

MRPS7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E11]

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-100 1x 100 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187T-01 50 Tests

Elab Fluor® Violet 610 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187T-02 100 Tests

Elab Fluor® Violet 610 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details