Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMA4 Rabbit pAb (APR21842N)

Product Specifications

Background

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. This gene encodes the alpha chain isoform laminin, alpha 4. The domain structure of alpha 4 is similar to that of alpha 3, both of which resemble truncated versions of alpha 1 and alpha 2, in that approximately 1,200 residues at the N-terminus (domains IV, V and VI) have been lost. Laminin, alpha 4 contains the C-terminal G domain which distinguishes all alpha chains from the beta and gamma chains. The RNA analysis from adult and fetal tissues revealed developmental regulation of expression, Tissue-specific utilization of alternative polyA-signal has been described in literature.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LAMA4 Rabbit pAb (APR21842N) .

Synonyms

LAMA4; CMD1JJ; LAMA3; LAMA4*-1

Gene ID

3910

UniProt

Q16363

Cellular Locus

Secreted, basement membrane, extracellular matrix, extracellular space

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/201kDa/202kDa Observed MW: 203kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3910

Uniprot URL

https://www.uniprot.org/uniprot/Q16363

AA Sequence

MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BubR1 (BUB1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI15E11]
TA500586BM 100 µL

BubR1 (BUB1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI15E11]

Sign In for Pricing
View Details
Ɑ-Biotinamido-ω-Trimethoxysilylpropylurea PEG
133000-25-71.1G 1 g

Ɑ-Biotinamido-ω-Trimethoxysilylpropylurea PEG

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: left
CP565734 150 µg

Tissue Protein Lysate, Ovary: left

Sign In for Pricing
View Details
Human LRCH1 activation kit by CRISPRa
GA108071 1 Kit

Human LRCH1 activation kit by CRISPRa

Sign In for Pricing
View Details
C16orf86 (NM_001012984) Human Recombinant Protein
TP318379L 1 mg

C16orf86 (NM_001012984) Human Recombinant Protein

Sign In for Pricing
View Details
Hippuric Acid
TRC-H356700-1G 1 g

Hippuric Acid

Sign In for Pricing
View Details