Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2F6 Rabbit pAb (APR21827N)

Product Specifications

Background

Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4 (+ T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NR2F6 Rabbit pAb (APR21827N) .

Synonyms

NR2F6; EAR-2; EAR2; ERBAL2

Gene ID

2063

UniProt

P10588

Cellular Locus

Nucleus

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2063

Uniprot URL

https://www.uniprot.org/uniprot/P10588

AA Sequence

MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4 (PDE4B) (NM_002600) Human Over-expression Lysate
LY400919 100 µg

PDE4 (PDE4B) (NM_002600) Human Over-expression Lysate

Sign In for Pricing
View Details
SGSH (C-term) Rabbit Polyclonal Antibody
AP53892PU-N 400 µL

SGSH (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vortex Mixer BVMX-104
BVMX-104 1 Unit

Vortex Mixer BVMX-104

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS710988 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
TIMM50 Human Gene Knockout Kit (CRISPR)
KN424744 1 Kit

TIMM50 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C8orf58 activation kit by CRISPRa
GA118612 1 Kit

Human C8orf58 activation kit by CRISPRa

Sign In for Pricing
View Details