Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL1 Rabbit pAb (APR21809N)

Product Specifications

Background

The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs) . ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARL1 Rabbit pAb (APR21809N) .

Synonyms

ARL1; ARFL1

Gene ID

400

UniProt

P40616

Cellular Locus

Cytoplasmic side, Golgi apparatus membrane, Lipid-anchor, Membrane, Peripheral membrane protein

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa/20kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=400

Uniprot URL

https://www.uniprot.org/uniprot/P40616

AA Sequence

KFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIR3DL2, NT (KIR3DL2, CD158K, NKAT4, Killer cell immunoglobulin-like receptor 3DL2, CD158 antigen-like family member K, MHC class I NK cell receptor, Natural killer-associated transcript 4, p70 natural killer cell receptor clone CL-5, CD158k) (FITC) discontinued
037463-FITC 200 µL

KIR3DL2, NT (KIR3DL2, CD158K, NKAT4, Killer cell immunoglobulin-like receptor 3DL2, CD158 antigen-like family member K, MHC class I NK cell receptor, Natural killer-associated transcript 4, p70 natural killer cell receptor clone CL-5, CD158k) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Desmoglein-12 Antibody (33-3D)
NBP2-50228 0.1 mL

Mouse Monoclonal Desmoglein-12 Antibody (33-3D)

Sign In for Pricing
View Details
Nedd4 Rabbit Polyclonal Antibody (Fluoro550)
orb3115983 100 µg

Nedd4 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Ovine Dehydroepiandrosterone (DHEA) ELISA Kit-Competitive
EK2F299 96 Tests

Ovine Dehydroepiandrosterone (DHEA) ELISA Kit-Competitive

Sign In for Pricing
View Details
IKK gamma (IKBKG) (NM_001099856) Human Tagged ORF Clone
RG212996 10 µg

IKK gamma (IKBKG) (NM_001099856) Human Tagged ORF Clone

Sign In for Pricing
View Details
LLR1 rabbit pAb
E44H12506 100 µL

LLR1 rabbit pAb

Sign In for Pricing
View Details